PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g16707.1.p
Common NameBRADI_5g16707, LOC100831406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 305aa    MW: 32638.6 Da    PI: 6.2528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g16707.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.1e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ll+d+v+  G+g+W+  ++  g++R++k+c++rw +yl
  Bradi5g16707.1.p 14 KGPWTPEEDKLLLDYVQASGPGNWRMLPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding51.91.8e-1667111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T+eE++ ++++++  G++ W+ Ia+ ++ gRt++++k++w++ 
  Bradi5g16707.1.p  67 RGPFTPEEHKSILQLHAVVGNK-WSMIAAQLP-GRTDNEIKNYWNTN 111
                       89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.154961IPR017930Myb domain
SuperFamilySSF466894.12E-3211108IPR009057Homeodomain-like
SMARTSM007172.2E-141363IPR001005SANT/Myb domain
PfamPF002497.8E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-241568IPR009057Homeodomain-like
CDDcd001673.84E-111661No hitNo description
PROSITE profilePS5129425.84862116IPR017930Myb domain
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.4E-1467112IPR001005SANT/Myb domain
CDDcd001676.61E-1169112No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MGRTPCCDIK GLKKGPWTPE EDKLLLDYVQ ASGPGNWRML PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGPF TPEEHKSILQ LHAVVGNKWS MIAAQLPGRT DNEIKNYWNT NLKKQLRQAA  120
LAGEHPALAA ITTTADSPAG TAATISSSPA ARHAAQWETA RLEAEARLSL LSTSGAAAAT  180
ATTSSSSSTV AAADAEHSAP DIFLRLWNSE VGDIFRSSSS TAAVAREEDA GVLLQRQEGV  240
LLPMEPKPAE DSSATSNVTT AAYGLTADEY QVFLDMAAED LGGFFHGGGF SQIYQSPSLF  300
AEFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-121AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581451.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1J0130.0I1J013_BRADI; Uncharacterized protein
STRINGBRADI5G16707.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-69myb domain protein 17